Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC6A4/5-HTTLPR/Serotonin transporter Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | SLC6A4/5-HTTLPR/Serotonin transporter |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SLC6A4/5-HTTLPR/Serotonin transporter Polyclonal specifically detects SLC6A4/5-HTTLPR/Serotonin transporter in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
SLC6A4/5-HTTLPR/Serotonin transporter | |
Polyclonal | |
Rabbit | |
Neuroscience | |
5HT transporter, 5-HTT, hSERT, HTT5-hydroxytryptamine transporter, Na+/Cl- dependent serotonin transporter, OCD1, SERT, sodium-dependent serotonin transporter, solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR, Solute carrier family 6 member 4,5HTT | |
SLC6A4 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
6532 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIHRSKGLQDLGGI | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title