Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC6A4/5-HTTLPR/Serotonin transporter Rabbit anti-Human, Rat, Clone: 5T7M2, Novus Biologicals™

Rabbit Monoclonal Antibody
Supplier: Novus Biologicals NBP31566820UL
This item is not returnable.
View return policy
Description
SLC6A4/5-HTTLPR/Serotonin transporter Monoclonal antibody specifically detects SLC6A4/5-HTTLPR/Serotonin transporter in Human, Rat samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
SLC6A4/5-HTTLPR/Serotonin transporter | |
Monoclonal | |
Unconjugated | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human, Rat | |
Purified |
Western Blot, Immunofluorescence | |
5T7M2 | |
Western Blot 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
5HT transporter, 5-HTT, hSERT, HTT5-hydroxytryptamine transporter, Na+/Cl- dependent serotonin transporter, OCD1, SERT, sodium-dependent serotonin transporter, solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR, Solute carrier family 6 member 4,5HTT | |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC6A4/5-HTTLPR/Serotonin transporter (P31645). METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLG | |
20 μg | |
Neuroscience | |
6532 | |
Store at -20°C. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction