Learn More
SLC6A4/5-HTTLPR/Serotonin transporter Rabbit anti-Human, Rat, Clone: 5T7M2, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | SLC6A4/5-HTTLPR/Serotonin transporter |
| Applications | Western Blot, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 5T7M2 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | 5HT transporter, 5-HTT, hSERT, HTT5-hydroxytryptamine transporter, Na+/Cl- dependent serotonin transporter, OCD1, SERT, sodium-dependent serotonin transporter, solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR, Solute carrier family 6 member 4,5HTT |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC6A4/5-HTTLPR/Serotonin transporter (P31645). METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLG |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.