SLC6A8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160082

Catalog No. NBP160082

Description

SLC6A8 Polyclonal specifically detects SLC6A8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC6A8
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Creatine transporter 1, CRT, CRTRcreatine transporter SLC6A8, CT1MGC87396, sodium- and chloride-dependent creatine transporter 1, solute carrier family 6 (neurotransmitter transporter, creatine), member 8, Solute carrier family 6 member 8
• Host Species: Rabbit
• Molecular Weight of Antigen: 70 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Bovine: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P48029
• Gene Symbols: SLC6A8
• Immunogen: Synthetic peptides corresponding to SLC6A8(solute carrier family 6 (neurotransmitter transporter, creatine), member 8) The peptide sequence was selected from the N terminal of SLC6A8. Peptide sequence CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6535
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only