Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC6A8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP160082
Description
SLC6A8 Polyclonal specifically detects SLC6A8 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SLC6A8 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Creatine transporter 1, CRT, CRTRcreatine transporter SLC6A8, CT1MGC87396, sodium- and chloride-dependent creatine transporter 1, solute carrier family 6 (neurotransmitter transporter, creatine), member 8, Solute carrier family 6 member 8 | |
Rabbit | |
70 kDa | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Bovine: 92%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
1 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
P48029 | |
SLC6A8 | |
Synthetic peptides corresponding to SLC6A8(solute carrier family 6 (neurotransmitter transporter, creatine), member 8) The peptide sequence was selected from the N terminal of SLC6A8. Peptide sequence CDQLADRRSPVIEFWENKVLRLSGGLEVPGALNWEVTLCLLACWVLVYFC The peptide sequence for this immunogen was taken from within the described region. | |
Protein A purified | |
RUO | |
6535 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction