Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC7A13 Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310159100UL
Description
SLC7A13 Polyclonal specifically detects SLC7A13 in Rat samples. It is validated for Western Blot.Specifications
SLC7A13 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
solute carrier family 7 member 13, AGT1, AGT-1, solute carrier family 7 (anionic amino acid transporter), member 13, XAT2 | |
The immunogen is a synthetic peptide directed towards the N terminal region of rat SLC7A13 (NP_001012100). Peptide sequence MAMDIEKKIYLKRQLGYFWGTNFLIINIIGAGIFVSPKGVLQYSSMNVGV | |
100 μg | |
Primary | |
Rat | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
157724 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction