SLC7A6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP230868

Catalog No. NBP230868

Description

SLC7A6 Polyclonal specifically detects SLC7A6 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC7A6
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q92536
• Gene Symbols: SLC7A6
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MEAREPGRPTPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKE
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Y+L amino acid transporter 2, LAT-2, LAT3, solute carrier family 7 (amino acid transporter light chain, y+L system), member 6, y+LAT-2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9057
• Target Species: Human
• Isotype: IgG

For Research Use Only