Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC7A7 Antibody, Novus Biologicals™

SLC7A7 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159856 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159856 100 μL
NBP15985620 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP159856 Supplier Novus Biologicals Supplier No. NBP159856
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SLC7A7 Polyclonal specifically detects SLC7A7 in Human samples. It is validated for Western Blot.

Specifications

Antigen SLC7A7
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9UM01
Gene Alias LAT3, LPI, Monocyte amino acid permease 2, MOP-2, solute carrier family 7 (cationic amino acid transporter, y+ system), member 7, Solute carrier family 7 member 7, Y+L amino acid transporter 1, Y+LAT1, y+LAT-1y(+)L-type amino acid transporter 1
Gene Symbols SLC7A7
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC7A7(solute carrier family 7 (cationic amino acid transporter, y+ system), member 7) The peptide sequence was selected from the middle region of SLC7A7. Peptide sequence WGTLVQDIFTYAKVLALIAVIVAGIVRLGQGASTHFENSFEGSSFAVGDI The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 56 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9056
Test Specificity Expected identity based on immunogen sequence: Guinea pig 79%, Mouse 79%, Rat 79%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.