Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC7A7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15985620UL
Description
SLC7A7 Polyclonal specifically detects SLC7A7 in Human samples. It is validated for Western Blot.Specifications
SLC7A7 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9UM01 | |
SLC7A7 | |
Synthetic peptides corresponding to SLC7A7(solute carrier family 7 (cationic amino acid transporter, y+ system), member 7) The peptide sequence was selected from the middle region of SLC7A7. Peptide sequence WGTLVQDIFTYAKVLALIAVIVAGIVRLGQG | |
Affinity Purified | |
RUO | |
9056 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
LAT3, LPI, Monocyte amino acid permease 2, MOP-2, solute carrier family 7 (cationic amino acid transporter, y+ system), member 7, Solute carrier family 7 member 7, Y+L amino acid transporter 1, Y+LAT1, y+LAT-1y(+)L-type amino acid transporter 1 | |
Rabbit | |
56 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?
Provide Content Correction