Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC9A7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	SLC9A7
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP179719 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP179719	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SLC9A7 Polyclonal specifically detects SLC9A7 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	SLC9A7
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_796327
Gene ID (Entrez)	84679
Immunogen	The immunogen for this antibody is Slc9a7. Peptide sequence SSSYTASTSLECGRRTKSSSEEVLERDLGMGDQKVSSRGTPLVFPLQENA.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	Na(+)/H(+) exchanger 7, NHE-7, NHE7SLC9A6, nonselective sodium potassium/proton exchanger, sodium/hydrogen exchanger 7, solute carrier family 9 (sodium/hydrogen exchanger), solute carrier family 9 (sodium/hydrogen exchanger), isoform 7, solute carrier family 9 (sodium/hydrogen exchanger), member 7, Solute carrier family 9 member 7
Gene Symbols	SLC9A7
Isotype	IgG
Molecular Weight of Antigen	80 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SLC9A7 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents