Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC9A9 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | SLC9A9 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SLC9A9 Polyclonal specifically detects SLC9A9 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC9A9 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| AUTS16, FLJ35613, Na(+)/H(+) exchanger 9, NHE9, NHE-9, putative protein product of Nbla00118, sodium/hydrogen exchanger 9, sodium/proton exchanger NHE9, solute carrier family 9 (sodium/hydrogen exchanger), solute carrier family 9 (sodium/hydrogen exchanger), isoform 9, solute carrier family 9 (sodium/hydrogen exchanger), member 9, Solute carrier family 9 member 9 | |
| SLC9A9 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q8IVB4 | |
| 285195 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: TDIESGTVYDCVKLTFSPSTLLVNITDQVYEYKYKREISQHNINPHQGNAIL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title