Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLCO1A2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$336.16 - $690.48
Specifications
| Antigen | SLCO1A2 |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL |
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SLCO1A2 Polyclonal specifically detects SLCO1A2 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.Specifications
| SLCO1A2 | |
| Western Blot, Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 6579 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYGITKDFLPFMKSLSCN | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL | |
| Polyclonal | |
| Rabbit | |
| Human | |
| OATP1, OATP1A2member 3, OATP-AOATP-1, OATPSolute carrier family 21 member 3, Organic anion-transporting polypeptide 1, Sodium-independent organic anion transporter, solute carrier organic anion transporter family member 1A2, solute carrier organic anion transporter family, member 1A2 | |
| SLCO1A2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title