Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLCO2A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 3 publications
$646.00
Specifications
Antigen | SLCO2A1 |
---|---|
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SLCO2A1 Polyclonal specifically detects SLCO2A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
SLCO2A1 | |
Polyclonal | |
Rabbit | |
Human | |
OATP2A1member 2, PGTmatrin F/G 1, Prostaglandin transporter, Solute carrier family 21 member 2, solute carrier organic anion transporter family member 2A1, solute carrier organic anion transporter family, member 2A1 | |
SLCO2A1 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
6578 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: PSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAH | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title