SLCO4A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18097825UL

Catalog No. NB434009

Description

SLCO4A1 Polyclonal specifically detects SLCO4A1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLCO4A1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: colon organic anion transporter, OATP1, OATP4A1, OATPE, OATP-E, OATP-RP1, organic anion-transporting polypeptide E, POAT, SLC21A12, solute carrier family 21 (organic anion transporter), member 12, solute carrier family 21 member 12, solute carrier organic anion transporter family member 4A1, solute carrier organic anion transporter family, member 4A1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 28231
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLCO4A1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GYPRQLPGSQRYAVMRAAEMHQLKDSSRGEASNPDFGKTIRDLPL
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only