Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLCO6A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	SLCO6A1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP159899 View Documents View Product Certificates	Novus Biologicals NBP159899	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SLCO6A1 Polyclonal specifically detects SLCO6A1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	SLCO6A1
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	Cancer/testis antigen 48, CT48Organic anion-transporting polypeptide I, Gonad-specific transporter, GSTOATP-I, MGC26949, OATP6A1Solute carrier family 21 member 19, OATPY, Organic anion-transporting polypeptide 6A1, SLC21A19, solute carrier organic anion transporter family member 6A1, solute carrier organic anion transporter family, member 6A1, testis-specific organic anion transporter
Gene Symbols	SLCO6A1
Isotype	IgG
Purification Method	Protein A purified

Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Gene Accession No.	Q86UG4
Gene ID (Entrez)	133482
Immunogen	Synthetic peptides corresponding to SLCO6A1(solute carrier organic anion transporter family, member 6A1) The peptide sequence was selected from the C terminal of SLCO6A1. Peptide sequence LAMTRVVPDKLRSLALGVSYVILRIFGTIPGPSIFKMSGETSCILRDVNK.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SLCO6A1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents