Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLFN12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17070620UL
Description
SLFN12 Polyclonal specifically detects SLFN12 in Human samples. It is validated for Western Blot.Specifications
SLFN12 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
schlafen family member 12 | |
Rabbit | |
Affinity Purified | |
RUO | |
55106 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
SLFN12 | |
Synthetic peptides corresponding to SLFN12(schlafen family member 12) The peptide sequence was selected from the N terminal of SLFN12. Peptide sequence KLRKKQNESVSRAMCALLNSGGGVIKAEIENEDYSYTKDGIGLDLENSFS. | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction