Slit3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159140

Catalog No. NBP159140

Description

Slit3 Polyclonal specifically detects Slit3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Slit3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KIAA0814, MEGF5Multiple epidermal growth factor-like domains protein 5, Multiple EGF-like domains protein 5, SLIL2, SLIL2FLJ10764, slit homolog 3 (Drosophila), slit homolog 3 protein, SLIT1, slit2, Slit-3slit (Drosophila) homolog 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 168 kDa
• Quantity: 100 μL
• Research Discipline: Growth and Development, Neuronal Cell Markers
• Gene ID (Entrez): 6586
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O75094
• Gene Symbols: SLIT3
• Immunogen: Synthetic peptides corresponding to SLIT3(slit homolog 3 (Drosophila)) The peptide sequence was selected from the N terminal of SLIT3 (NP_003053). Peptide sequence PRRLANKRISQIKSKKFRCSGSEDYRSRFSSECFMDLVCPEKCRCEGTIV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only