SLP-2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179903

Catalog No. NBP179903

Description

SLP-2 Polyclonal specifically detects SLP-2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLP-2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EPB72-like protein 2, HSPC108, SLP2, SLP-2stomatin-like protein 2, stomatin (EPB72)-like 2, stomatin-like 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 39 kDa
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 30968
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_038470
• Gene Symbols: STOML2
• Immunogen: The specific Immunogen is proprietary information. Peptide sequence VTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 86%; Guinea pig: 79%.
• Target Species: Human, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG