Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLP-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | SLP-2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17990320
|
Novus Biologicals
NBP17990320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179903
|
Novus Biologicals
NBP179903 |
100 μL |
Each for $487.50
|
|
|||||
Description
SLP-2 Polyclonal specifically detects SLP-2 in Human samples. It is validated for Western Blot.Specifications
| SLP-2 | |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| EPB72-like protein 2, HSPC108, SLP2, SLP-2stomatin-like protein 2, stomatin (EPB72)-like 2, stomatin-like 2 | |
| STOML2 | |
| IgG | |
| 39 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_038470 | |
| 30968 | |
| The specific Immunogen is proprietary information. Peptide sequence VTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEELDRVK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title