SLURP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP213351

Catalog No. NBP213351

Description

SLURP1 Polyclonal specifically detects SLURP1 in Human, Chinese Hamster samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLURP1
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: ANUPARS(component B)-81/S, ARS component B, ArsB, ARSlymphocyte antigen 6-like secreted, LY6LS, MDMsecreted Ly-6/uPAR-related protein 1, neoplastic urinary protein, secreted LY6/PLAUR domain containing 1, secreted Ly6/uPAR related protein 1, SLURP-1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLURP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: KEPMTSASCRTITRCKPEDTACMTTLVTVEAEYPFNQSPVVTRSCSSSCVATDPDSIGAAHLIFCCFRDLCN
• Quantity: 0.1 mL
• Research Discipline: Cytokine Research
• Gene ID (Entrez): 57152
• Target Species: Human, Chinese Hamster
• Isotype: IgG

For Research Use Only