Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Smad5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP232406
Description
Smad5 Polyclonal specifically detects Smad5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Smad5 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
hSmad5, JV5-1DKFZp781O1323, MAD homolog 5, MAD, mothers against decapentaplegic homolog 5 (Drosophila), MADH5mothers against decapentaplegic homolog 5, mothers against decapentaplegic homolog 5, mothers against decapentaplegic, drosophila, homolog of, 5, Mothers against DPP homolog 5, SMA- and MAD-related protein 5, SMAD 5, SMAD family member 5DKFZp781C1895, SMAD, mothers against DPP homolog 5, SMAD, mothers against DPP homolog 5 (Drosophila), Smad5 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
SMAD5 | |
This antibody was developed against a recombinant protein corresponding to amino acids: PDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYE | |
0.1 mL | |
Signal Transduction | |
4090 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction