SMAD6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256758

Catalog No. NBP256758

Description

SMAD6 Polyclonal specifically detects SMAD6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SMAD6
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: hSMAD6, HsT17432, MAD homolog 6, MADH6SMAD, mothers against DPP homolog 6 (Drosophila), MADH7, mothers against decapentaplegic homolog 6, Mothers against decapentaplegic, drosophila, homolog of, 6, Mothers against DPP homolog 6, SMAD 6, SMAD family member 6MAD, mothers against decapentaplegic homolog 6 (Drosophila), SMAD, mothers against DPP homolog 6, Smad6
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SMAD6
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PRPMSEPGAGAGSSLLDVAEPGGPGWLPESDCETVTCCLF
• Quantity: 100 μL
• Research Discipline: Stem Cell Signaling Pathway
• Gene ID (Entrez): 4091
• Target Species: Human
• Isotype: IgG

For Research Use Only