SMARCA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP256279	Novus Biologicals NBP256279	100 μL
NB403747	Novus Biologicals NBP25627925UL	25 μL

Description

SMARCA1 Polyclonal specifically detects SMARCA1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SMARCA1
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: ATP-dependent helicase SMARCA1, DKFZp686D1623, EC 3.6.1, EC 3.6.4.-, FLJ41547, global transcription activator homologous sequence, Nucleosome-remodeling factor subunit SNF2L, NURF140, probable global transcription activator SNF2L1, SNF2L, SNF2L1ISWI, SNF2LB, SNF2-like 1, SNF2LT, subfamily a, member 1, sucrose nonfermenting 2-like protein 1, SWI, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin a1, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 1, SWI2
• Gene Symbols: SMARCA1
• Isotype: IgG
• Purification Method: Affinity Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 6594
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQ
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only