SMARCA6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157145

Catalog No. NBP157145

Description

SMARCA6 Polyclonal specifically detects SMARCA6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SMARCA6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 3.6.1, EC 3.6.4.-, helicase, lymphoid-specific, LSHSWI/SNF2-related, matrix-associated, actin-dependent regulator of chromatin, Nbla10143, PASGFLJ10339, Proliferation-associated SNF2-like protein, SMARCA6lymphoid-specific helicase, subfamily A, member 6, SWI/SNF2-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 6
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Canine: 92%; Guinea pig: 92%; Equine: 92%; Mouse: 92%; Pig: 92%; Rat: 92%; Xenopus: 85%; Chicken: 85%; Rabbit: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NRZ9
• Gene Symbols: HELLS
• Immunogen: Synthetic peptides corresponding to HELLS(helicase, lymphoid-specific) The peptide sequence was selected from the middle region of HELLS. Peptide sequence QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREKVISDKDLELLLDRSD.
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 3070
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.