Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SMARCA6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SMARCA6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SMARCA6 Polyclonal specifically detects SMARCA6 in Human samples. It is validated for Western Blot.Specifications
SMARCA6 | |
Polyclonal | |
Rabbit | |
Core ESC Like Genes, Stem Cell Markers | |
EC 3.6.1, EC 3.6.4.-, helicase, lymphoid-specific, LSHSWI/SNF2-related, matrix-associated, actin-dependent regulator of chromatin, Nbla10143, PASGFLJ10339, Proliferation-associated SNF2-like protein, SMARCA6lymphoid-specific helicase, subfamily A, member 6, SWI/SNF2-related matrix-associated actin-dependent regulator of chromatinsubfamily A member 6 | |
HELLS | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q9NRZ9 | |
3070 | |
Synthetic peptides corresponding to HELLS(helicase, lymphoid-specific) The peptide sequence was selected from the middle region of HELLS. Peptide sequence QSGLNLSKNFLDPKELMELLKSRDYEREIKGSREKVISDKDLELLLDRSD. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title