SMARCD2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB125845	Novus Biologicals NBP310472100UL	100 μg

Description

SMARCD2 Polyclonal specifically detects SMARCD2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SMARCD2
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Host Species: Rabbit
• Research Discipline: Chromatin Research
• Formulation: PBS buffer, 2% sucrose
• Gene ID (Entrez): 6603
• Primary or Secondary: Primary
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Classification: Polyclonal
• Form: Purified
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: 60 kDa BRG-1/Brm-associated factor subunit B, BAF60B, BRG1-associated factor 60B, chromatin remodeling complex BAF60B subunit, CRACD2, mammalian chromatin remodeling complex BRG1-associated factor 60B, PRO2451, Rsc6p, SWI/SNF complex 60 kDa subunit B, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2, Swp73-like protein
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SMARCD2 (NP_003068). Peptide sequence STDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRH
• Purification Method: Affinity purified