Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SMARCD3 Antibody, Novus Biologicals™

SMARCD3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP179718 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179718 100 μL
NBP17971820 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP179718 Supplier Novus Biologicals Supplier No. NBP179718
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SMARCD3 Polyclonal specifically detects SMARCD3 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen SMARCD3
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_080167
Gene Alias 60 kDa BRG-1/Brm-associated factor subunit C, 60kDa BRG-1/Brm associated factor subunit c, BAF60Cchromatin remodeling complex BAF60C subunit, BRG1-associated factor 60C, CRACD3, mammalian chromatin remodeling complex BRG1-associated factor 60C, MGC111010, Rsc6p, subfamily d, member 3, SWI/SNF complex 60 kDa subunit C, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily D member 3, Swp73-like protein
Gene Symbols SMARCD3
Host Species Rabbit
Immunogen The immunogen for this antibody is Smarcd3. Peptide sequence DLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLV.
Molecular Weight of Antigen 55 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 6604
Test Specificity Expected identity based on immunogen sequence: Chicken: 84%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.