SMARCD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179718

Catalog No. NBP179718

Description

SMARCD3 Polyclonal specifically detects SMARCD3 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: SMARCD3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 60 kDa BRG-1/Brm-associated factor subunit C, 60kDa BRG-1/Brm associated factor subunit c, BAF60Cchromatin remodeling complex BAF60C subunit, BRG1-associated factor 60C, CRACD3, mammalian chromatin remodeling complex BRG1-associated factor 60C, MGC111010, Rsc6p, subfamily d, member 3, SWI/SNF complex 60 kDa subunit C, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily D member 3, Swp73-like protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 55 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 84%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_080167
• Gene Symbols: SMARCD3
• Immunogen: The immunogen for this antibody is Smarcd3. Peptide sequence DLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6604
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.