SMARCD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP17971820UL

Catalog No. NBP17971820

Description

SMARCD3 Polyclonal specifically detects SMARCD3 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: SMARCD3
• Classification: Polyclonal
• Dilution: Western Blot 1:1000
• Gene Accession No.: NP_080167
• Gene Symbols: SMARCD3
• Immunogen: The immunogen for this antibody is Smarcd3. Peptide sequence DLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLV.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6604
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 60 kDa BRG-1/Brm-associated factor subunit C, 60kDa BRG-1/Brm associated factor subunit c, BAF60Cchromatin remodeling complex BAF60C subunit, BRG1-associated factor 60C, CRACD3, mammalian chromatin remodeling complex BRG1-associated factor 60C, MGC111010, Rsc6p, subfamily d, member 3, SWI/SNF complex 60 kDa subunit C, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily D member 3, Swp73-like protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 55 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Mouse
• Isotype: IgG