Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SMARCD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | SMARCD3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179718
![]() |
Novus Biologicals
NBP179718 |
100 μL |
Each for $480.74
|
|
|||||
NBP17971820
![]() |
Novus Biologicals
NBP17971820UL |
20 μL | N/A | N/A | N/A | ||||
Description
SMARCD3 Polyclonal specifically detects SMARCD3 in Mouse samples. It is validated for Western Blot.Specifications
| SMARCD3 | |
| Polyclonal | |
| Rabbit | |
| NP_080167 | |
| 6604 | |
| The immunogen for this antibody is Smarcd3. Peptide sequence DLKVMTDVAGNPEEERRAEFYHQPWSQEAVSRYFYCKIQQRRQELEQSLV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 60 kDa BRG-1/Brm-associated factor subunit C, 60kDa BRG-1/Brm associated factor subunit c, BAF60Cchromatin remodeling complex BAF60C subunit, BRG1-associated factor 60C, CRACD3, mammalian chromatin remodeling complex BRG1-associated factor 60C, MGC111010, Rsc6p, subfamily d, member 3, SWI/SNF complex 60 kDa subunit C, SWI/SNF related, matrix associated, actin dependent regulator of chromatin, SWI/SNF-related matrix-associated actin-dependent regulator of chromatinsubfamily D member 3, Swp73-like protein | |
| SMARCD3 | |
| IgG | |
| 55 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title