Invitrogen™ SMC3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA580041

Catalog No. PIPA580041

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Brain Tissue, Rat Liver Tissue, Rat Testis Tissue, HELA whole cell, A549 whole cell, MCF-7 whole cell, NIH3T3 whole cell. IHC: mouse intestine tissue, rat kidney tissue, human intestinal cancer tissue.

This gene belongs to the SMC3 subfamily of SMC proteins. The encoded protein occurs in certain cell types as either an intracellular, nuclear protein or a secreted protein. The nuclear form, known as structural maintenance of chromosomes 3, is a component of the multimeric cohesin complex that holds together sister chromatids during mitosis, enabling proper chromosome segregation. Post-translational modification of the encoded protein by the addition of chondroitin sulfate chains gives rise to the secreted proteoglycan bamacan, an abundant basement membrane protein.

Specifications

• Antigen: SMC3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: SMC3
• Gene Alias: Bam; Bamacan; basement membrane chondroitin sulfate proteoglycan; basement membrane-associated chondroitin proteoglycan; BMH; CDLS3; chondroitin sulfate proteoglycan 6; chondroitin sulfate proteoglycan 6 (bamacan); chromosome segregation protein SmcD; Chromosome-associated polypeptide; cspg6; HCAP; im:7142991; mad member-interacting protein 1; Mmip1; SMC protein 3; Smc3; SMC-3; SMC3 protein; SMC3L1; SmcD; structural maintenace of chromosomes 3; structural maintenance of chromosomes 3; structural maintenance of chromosomes protein 3; structural maintenance of chromosomes protein 3-like protein; wu:fb22e01; wu:fc30d07
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 13006, 29486, 9126
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P97690, Q9CW03, Q9UQE7
• Gene Symbols: SMC3
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SMC3 (1178-1216aa ELLESADKFYGVKFRNKVSHIDVITAEMAKDFVEDDTTH).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov