SMCR7L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159480

Catalog No. NBP159480

Description

SMCR7L Polyclonal specifically detects SMCR7L in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SMCR7L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dJ1104E15.3, FLJ20232, HSU79252, MID51, Smith-Magenis syndrome chromosomal region candidate gene 7 protein-like, Smith-Magenis syndrome chromosome region, candidate 7-like
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54471
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NQG6
• Gene Symbols: SMCR7L
• Immunogen: Synthetic peptides corresponding to SMCR7L(Smith-Magenis syndrome chromosome region, candidate 7-like) The peptide sequence was selected from the N terminal of SMCR7L. Peptide sequence GAAMLGIATLAVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLN.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only