Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SMCX Antibody, Novus Biologicals™

SMCX Antibody, Novus Biologicals™
SDP

Catalog No. NB395222 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395222 25 μL
NBP255009 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB395222 Supplier Novus Biologicals Supplier No. NBP25500925UL
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SMCX Polyclonal specifically detects SMCX in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen SMCX
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias DXS1272EMRXJ, EC 1.14.11, EC 1.14.11.-, Histone demethylase JARID1C, JARID1Clysine-specific demethylase 5C, jumonji, AT rich interactive domain 1C, Jumonji, AT rich interactive domain 1C (RBP2-like), Jumonji/ARID domain-containing protein 1C, lysine (K)-specific demethylase 5C, MRXSJ, Protein SmcX, Protein Xe169, Smcx homolog, X chromosome, SMCXselected cDNA on X, Smcy homolog, X-linked, Smcy homolog, X-linked (mouse), XE169JmjC domain-containing protein SMCX
Gene Symbols KDM5C
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LGLMAKDKTLRKKDKEGPECPPTVVVKEELGGDVKVESTSPKTFLESKEELSHSPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRG
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8242
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.