Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SMIM1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$646.00
Specifications
| Antigen | SMIM1 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SMIM1 Polyclonal specifically detects SMIM1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SMIM1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Small Integral Membrane Protein 1, Small Integral Membrane Protein 1 (Vel Blood Group), Vel, Vel Blood Group Antigen | |
| SMIM1 | |
| IgG | |
| Affinity Purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| B2RUZ4 | |
| 388588 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: QPQESHVHYSRWEDGSRDGVSLGAVSSTEEASRCRRISQRLCTGKL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title