Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SMOX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	SMOX
Applications	Immunocytochemistry, Immunofluorescence
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP255775 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP255775	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB435541 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25577525UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SMOX Polyclonal specifically detects SMOX in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen	SMOX
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene ID (Entrez)	54498
Immunogen	This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HDKPVNAESQNSVGVFTREEVRNRIRNDPDDPEATKRLKLAMIQQYLKVESCESSSHSMDEVSLSAFGEWTEIPGAHHIIPSGFMRVVE
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Applications	Immunocytochemistry, Immunofluorescence
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	C20orf16, chromosome 20 open reading frame 16, EC 1.5.3.16, flavin containing amine oxidase, flavin-containing spermine oxidase, FLJ20746, MGC1010, PAO, PAO-1, PAOh1, Polyamine oxidase 1, putative cyclin G1 interacting protein, SMOdJ779E11.1, spermine oxidase
Gene Symbols	SMOX
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SMOX Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents