Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ SMYD3 Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA580045
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, COLO320 whole cell. IHC: human intestinal cancer tissue.
SMYD3 (histone-lysine N-methyltransferase) methylates Lys-4 of histone H3 and Lys-5 of histone H4. It induces di- and tri-methylation. SMYD3 plays an important role in transcriptional activation as a member of an RNA polymerase complex.
Specifications
SMYD3 | |
Polyclonal | |
Unconjugated | |
SMYD3 | |
2410008A19Rik; bA74P14.1; bA74P14.1 (novel protein); histone-lysine N-methyltransferase SMYD3; KMT3E; SET and MYND domain containing 3; SET and MYND domain-containing protein 3; Smyd3; Zinc finger MYND domain-containing protein 1; zinc finger protein, subfamily 3A (MYND domain containing), 1; zinc finger, MYND domain containing 1; ZMYND1; ZNFN3A1 | |
Rabbit | |
Antigen Affinity Chromatography | |
RUO | |
64754 | |
-20°C | |
Lyophilized |
Immunohistochemistry (Paraffin), Western Blot | |
500 μg/mL | |
PBS with 5mg BSA and 0.05mg sodium azide | |
Q9H7B4 | |
SMYD3 | |
A synthetic peptide corresponding to a sequence at the C-terminus of human SMYD3 (388-428aa QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS). | |
100 μg | |
Primary | |
Human | |
Antibody | |
IgG |
Safety and Handling
WARNING: Cancer - www.P65Warnings.ca.gov
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction