Invitrogen™ SMYD3 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA580045

Catalog No. PIPA580045

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: HELA whole cell, COLO320 whole cell. IHC: human intestinal cancer tissue.

SMYD3 (histone-lysine N-methyltransferase) methylates Lys-4 of histone H3 and Lys-5 of histone H4. It induces di- and tri-methylation. SMYD3 plays an important role in transcriptional activation as a member of an RNA polymerase complex.

Specifications

• Antigen: SMYD3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: SMYD3
• Gene Alias: 2410008A19Rik; bA74P14.1; bA74P14.1 (novel protein); histone-lysine N-methyltransferase SMYD3; KMT3E; SET and MYND domain containing 3; SET and MYND domain-containing protein 3; Smyd3; Zinc finger MYND domain-containing protein 1; zinc finger protein, subfamily 3A (MYND domain containing), 1; zinc finger, MYND domain containing 1; ZMYND1; ZNFN3A1
• Host Species: Rabbit
• Purification Method: Antigen Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 64754
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: Q9H7B4
• Gene Symbols: SMYD3
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human SMYD3 (388-428aa QAMKNLRLAFDIMRVTHGREHSLIEDLILLLEECDANIRAS).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov