SMYD4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179406

Catalog No. NBP179406

Description

SMYD4 Polyclonal specifically detects SMYD4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SMYD4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KIAA1936ZMYND21, SET and MYND domain containing 4, SET and MYND domain-containing protein 4
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 114826
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_443160
• Gene Symbols: SMYD4
• Immunogen: Synthetic peptide directed towards the N terminal of human SMYD4The immunogen for this antibody is SMYD4. Peptide sequence EGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDMSLCHANRSAALFHLGQYE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Rabbit: 92%; Pig: 85%; Canine: 84%.
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only