Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SNAP43 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180296
Description
SNAP43 Polyclonal specifically detects SNAP43 in Human samples. It is validated for Western Blot.Specifications
SNAP43 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Proximal sequence element-binding transcription factor subunit gamma, PSE-binding factor subunit gamma, PTF subunit gamma, PTFgamma, small nuclear RNA activating complex, polypeptide 1, 43kD, small nuclear RNA activating complex, polypeptide 1, 43kDa, Small nuclear RNA-activating complex polypeptide 1, SNAP43SNAPc 43 kDa subunit, SNAPc subunit 1, snRNA-activating protein complex 43 kDa subunit, snRNA-activating protein complex subunit 1 | |
Rabbit | |
Protein A purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%. | |
Human | |
Purified |
Western Blot | |
1 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_003073 | |
SNAPC1 | |
Synthetic peptide directed towards the C terminal of human SNAPC1. Peptide sequence GQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVIT. | |
100 μL | |
DNA replication Transcription Translation and Splicing | |
6617 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction