Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SNAP47 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SNAP47 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SNAP47 Polyclonal specifically detects SNAP47 in Human samples. It is validated for Western Blot.Specifications
SNAP47 | |
Polyclonal | |
Rabbit | |
Q5SQN1 | |
116841 | |
Synthetic peptides corresponding to C1ORF142 The peptide sequence was selected from the middle region of C1ORF142 (NP_444280). Peptide sequence TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C1orf142, Epididymis luminal protein 170, FLJ12517, HEL170, SNAP-47chromosome 1 open reading frame 142, SVAP1DKFZp686M10160, Synaptosomal-associated 47 kDa protein, synaptosomal-associated protein 47, synaptosomal-associated protein, 47kDa | |
SNAP47 | |
IgG | |
52.5 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title