Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SNAP47 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SNAP47 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156894
|
Novus Biologicals
NBP156894 |
100 μL |
Each for $436.00
|
|
NBP15689420
|
Novus Biologicals
NBP15689420UL |
20 μL | This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000. | N/A |
Description
SNAP47 Polyclonal specifically detects SNAP47 in Human samples. It is validated for Western Blot.Specifications
| SNAP47 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C1orf142, Epididymis luminal protein 170, FLJ12517, HEL170, SNAP-47chromosome 1 open reading frame 142, SVAP1DKFZp686M10160, Synaptosomal-associated 47 kDa protein, synaptosomal-associated protein 47, synaptosomal-associated protein, 47kDa | |
| SNAP47 | |
| IgG | |
| Affinity Purified | |
| 52.5 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q5SQN1 | |
| 116841 | |
| Synthetic peptides corresponding to C1ORF142 The peptide sequence was selected from the middle region of C1ORF142 (NP_444280). Peptide sequence TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title