SNAPC5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP309361100UL

Catalog No. NB123623

Description

SNAPC5 Polyclonal specifically detects SNAPC5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SNAPC5
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: small nuclear RNA activating complex, polypeptide 5, 19kDa, Small nuclear RNA-activating complex polypeptide 5, SNAP19small nuclear RNA activating complex, polypeptide 5, 19kD, SNAPc 19 kDa subunit, SNAPc subunit 5, snRNA-activating protein complex 19 kDa subunit, snRNA-activating protein complex subunit 5
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SNAPC5 (NP_006040). Peptide sequence KEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSH
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10302
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.