Learn More
Description
Specifications
Specifications
| Antigen | SNAPC5 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | small nuclear RNA activating complex, polypeptide 5, 19kDa, Small nuclear RNA-activating complex polypeptide 5, SNAP19small nuclear RNA activating complex, polypeptide 5, 19kD, SNAPc 19 kDa subunit, SNAPc subunit 5, snRNA-activating protein complex 19 kDa subunit, snRNA-activating protein complex subunit 5 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human SNAPC5 (NP_006040). Peptide sequence KEEETLLRLKAALHDQLNRLKVEELALQSMISSRRGDEMLSSHTVPEQSH |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
