Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SNRK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SNRK |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SNRK Polyclonal specifically detects SNRK in Human samples. It is validated for Western Blot.Specifications
SNRK | |
Polyclonal | |
Rabbit | |
Protein Kinase | |
DKFZp779A1866, EC 2.7.11, EC 2.7.11.1, HSNFRK, KIAA0096FLJ20224, SNF related kinase, SNF-1 related kinase, SNF1-related kinase, SNF-related serine/threonine-protein kinase, SNFRK | |
SNRK | |
IgG | |
84 kDa |
Western Blot | |
Unconjugated | |
RUO | |
Q9NRH2 | |
54861 | |
Synthetic peptides corresponding to SNRK(SNF related kinase) The peptide sequence was selected from the middle region of SNRK. Peptide sequence SSSETSDDDSESRRRLDKDSGFTYSWHRRDSSEGPPGSEGDGGGQSKPSN. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title