SNRPD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP187028

Catalog No. NBP187028

Description

SNRPD2 Polyclonal specifically detects SNRPD2 in Human, Mouse, Rat, Drosophila samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SNRPD2
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: small nuclear ribonucleoprotein D2 polypeptide (16.5kD), small nuclear ribonucleoprotein D2 polypeptide 16.5kDa, small nuclear ribonucleoprotein Sm D2, Sm-D2SMD2, snRNP core protein D2, SNRPD1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SNRPD2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:REEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTE
• Quantity: 0.1 mL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 6633
• Target Species: Human, Mouse, Rat, Drosophila
• Isotype: IgG

For Research Use Only