SNRPD2P2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP170708

Catalog No. NBP170708

Description

SNRPD2P2 Polyclonal specifically detects SNRPD2P2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SNRPD2P2
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: SNRPD2P2 small nuclear ribonucleoprotein D2 pseudogene 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 645339
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: LOC645339
• Immunogen: Synthetic peptides corresponding to LOC645339 (hypothetical LOC645339) The peptide sequence was selected from the middle region of LOC645339. Peptide sequence MVLENVKEMCTEVPKGGNGGKGKKKSKPANKDHFISKLFLCRDSVITNKW.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG