Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SNRPF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$208.00 - $499.50

Specifications

Antigen	SNRPF
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15746320 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15746320UL	20 μL	Each for $208.00	Only null left	Sign In or Register to check your price. Add to Cart

NBP157463 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP157463	100 μL	Each for $499.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

SNRPF Polyclonal specifically detects SNRPF in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	SNRPF
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Alias	PBSCF, Sm protein F, small nuclear ribonucleoprotein polypeptide F, SMF, Sm-Fsmall nuclear ribonucleoprotein F, snRNP-F
Gene Symbols	SNRPF
Isotype	IgG
Purification Method	Protein A purified

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Gene Accession No.	P62306
Gene ID (Entrez)	6636
Immunogen	Synthetic peptides corresponding to SNRPF (small nuclear ribonucleoprotein polypeptide F) The peptide sequence was selected from the N terminal of SNRPF. Peptide sequence MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEY.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SNRPF Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents