Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SNTG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SNTG1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SNTG1 Polyclonal specifically detects SNTG1 in Human samples. It is validated for Western Blot.Specifications
SNTG1 | |
Polyclonal | |
Rabbit | |
Q9NSN8 | |
54212 | |
Synthetic peptides corresponding to SNTG1(syntrophin, gamma 1) The peptide sequence was selected from the middle region of SNTG1. Peptide sequence RFSQYVPGTDLSRQNAFQVIAVDGVCTGIIQCLSAEDCVDWLQAIATNIS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
G1SYNsyntrophin-4, gamma-1-syntrophin, gamma1-syntrophin, SYN4syntrophin 4, syntrophin, gamma 1, Syntrophin-4 | |
SNTG1 | |
IgG | |
58 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title