Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SNX10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SNX10 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SNX10 Polyclonal specifically detects SNX10 in Mouse samples. It is validated for Western Blot.Specifications
SNX10 | |
Polyclonal | |
Rabbit | |
NP_001120820 | |
29887 | |
The immunogen for this antibody is Snx10. Peptide sequence DFLRKVLQNALLLSDSSLHLFLQSHLNSEDIEACVSGQTKYSVEEAIHKF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
MGC33054, sorting nexin 10, sorting nexin-10 | |
SNX10 | |
IgG | |
22 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title