SNX33 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP181125

Catalog No. NBP181125

Description

SNX33 Polyclonal specifically detects SNX33 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SNX33
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q8WV41
• Gene Symbols: SNX33
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VRSGVEAFILGDVPMMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQTK
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 257364
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: MGC32065, SH3 and PX domain containing 3, SH3PXD3CSH3PX3, SNX30SH3 and PX domain-containing protein 3, sorting nexin 33, sorting nexin-33
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only