SNX7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP158862

Catalog No. NBP158862

Description

SNX7 Polyclonal specifically detects SNX7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SNX7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp564F052, MGC8717, sorting nexin 7, sorting nexin-7
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Canine: 92%; Guinea pig: 92%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%; Chicken: 84%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UNH6
• Gene Symbols: SNX7
• Immunogen: Synthetic peptides corresponding to SNX7(sorting nexin 7) The peptide sequence was selected from the middle region of SNX7. Peptide sequence LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 51375
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.