Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SNX7 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen SNX7
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15886220
SDP
View Documents
Novus Biologicals
NBP15886220UL
20 μL
Each for $206.00
Only null left
Add to Cart
 
NBP158862
SDP
View Documents
Novus Biologicals
NBP158862
100 μL
Each for $487.50
Only null left
Add to Cart
 
Description

Description

SNX7 Polyclonal specifically detects SNX7 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SNX7
Polyclonal
Rabbit
Signal Transduction
DKFZp564F052, MGC8717, sorting nexin 7, sorting nexin-7
SNX7
IgG
Western Blot
Unconjugated
RUO
Q9UNH6
51375
Synthetic peptides corresponding to SNX7(sorting nexin 7) The peptide sequence was selected from the middle region of SNX7. Peptide sequence LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND.
Primary
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.