Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SNX7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15886220UL
Description
SNX7 Polyclonal specifically detects SNX7 in Human samples. It is validated for Western Blot.Specifications
SNX7 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9UNH6 | |
SNX7 | |
Synthetic peptides corresponding to SNX7(sorting nexin 7) The peptide sequence was selected from the middle region of SNX7. Peptide sequence LDSKVEVLTYKKADTDLLPEEIGKLEDKVECANNALKADWERWKQNMQND. | |
20 μL | |
Signal Transduction | |
51375 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DKFZp564F052, MGC8717, sorting nexin 7, sorting nexin-7 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction