Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Sodium Potassium ATPase Alpha 2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310276100UL
Description
Sodium Potassium ATPase Alpha 2 Polyclonal specifically detects Sodium Potassium ATPase Alpha 2 in Human samples. It is validated for Western Blot.Specifications
Sodium Potassium ATPase Alpha 2 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
alpha-A(+) catalytic polypeptide, ATPase, Na+/K+ transporting, alpha 2 (+) polypeptide, ATPase, Na+/K+ transporting, alpha 2 polypeptide, EC 3.6.3, EC 3.6.3.9, KIAA0778, MGC59864, MHP2, migraine, hemiplegic 2, Na(+)/K(+) ATPase alpha-2 subunit, Na+/K+ ATPase, alpha-B polypeptide, Sodium pump subunit alpha-2, sodium/potassium-transporting ATPase alpha-2 chain, sodium/potassium-transporting ATPase subunit alpha-2, sodium-potassium ATPase | |
The immunogen is a synthetic peptide directed towards the N terminal region of human Sodium Potassium ATPase Alpha 2 (NP_000693.1). Peptide sequence TTPEWVKFCRQLFGGFSILLWIGAILCFLAYGIQAAMEDEPSNDNLYLGV | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
477 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction